DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and Smok2a

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_038769.1 Gene:Smok2a / 27263 MGIID:1351487 Length:504 Species:Mus musculus


Alignment Length:438 Identity:130/438 - (29%)
Similarity:211/438 - (48%) Gaps:81/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYE 105
            ||:..|||.|....||||.:.:|.|.||:|:|.|   .|.:......|..:|....||:|..|.:
Mouse    28 YEMLGTIGHGGSTKVKLARHRLTGTHVAVKMIPK---REYWCKPLMSEAELLMMADHPNIISLLQ 89

  Fly   106 VMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVL 170
            |:|::..:||:.|......::.|:...|.::|.||..:|.||:||::|||.:|:||||||.:|::
Mouse    90 VIETKKKVYLIMELCEGKSLYQHIRNAGYLQEDEARALFKQLLSAINYCHNQGIVHRDLKPDNIM 154

  Fly   171 LDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGA 235
            ::||..:|:.|||.....:.|..|..:||:.|::||||.....|||||.|:|:||||||.:|.|.
Mouse   155 VEKDGRVKIIDFGLGIQVKPGQKLNLFCGTYPFSAPEVLLSRPYDGPKIDVWTLGVVLYFMVTGK 219

  Fly   236 LPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQ 300
            :|||..:|.:|:.::|.||:.:|..:|.:...||..::...|:.|.|:.:::.|.|:::      
Mouse   220 IPFDAASIEKLRKQIVAGKYSVPCRLSVKLHHLITLLMTDNPELRPTVAEVMMHPWVTK------ 278

  Fly   301 EQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNI 365
                      |||.......       ...|.:.|..::..|..: |..|..|..|:.:::|:..
Mouse   279 ----------GSGVFPDPCE-------EQIPLKPDPAIVKAMGHI-GFQAQDIEDSLRQRKFNET 325

  Fly   366 YAIYNLLHDKLQQ-------------------------------RRRENQRLQHHASLAYSRSRK 399
            .|.|.||..::.:                               ||||.:    ..||..|.:|:
Mouse   326 MASYCLLKKQILKECDRPIRAQPMNPSVTPFPSLVDTPTFHLGLRRRETE----PTSLRLSANRQ 386

  Fly   400 TSI----TTGVVDR--------SEPV-------KQESLDRLSPLSNAN 428
            .|:    |:...||        |.|:       :..:..|..|..|:|
Mouse   387 MSVCGRSTSKKRDRSFSWPGVLSRPINITPTMDQTHTCTRSVPCINSN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 96/250 (38%)
S_TKc 41..292 CDD:214567 96/250 (38%)
UBA_SIK 335..380 CDD:270523 11/75 (15%)
Smok2aNP_038769.1 STKc_AMPK-like 27..275 CDD:270905 96/249 (39%)
S_TKc 28..276 CDD:214567 96/250 (38%)
UBA_MARK_Par1 295..334 CDD:270522 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 376..403 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..469
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.