DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and ppk25

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_596657.1 Gene:ppk25 / 2540267 PomBaseID:SPBC32C12.03c Length:423 Species:Schizosaccharomyces pombe


Alignment Length:417 Identity:139/417 - (33%)
Similarity:221/417 - (52%) Gaps:33/417 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSSTP---QNYKVPSTSK--ISVDKLL-------RVGYYELEKTIGKGNFAVVKLATNIVTKTKV 67
            |.|.|   ||.|:..::|  .|:...:       :||.:.::||||.|:...|||..||:|..|.
pombe    15 TFSIPKRSQNIKINQSTKHQRSISDFVGTAGPGRQVGNWIIKKTIGAGSMGKVKLVVNILTGEKA 79

  Fly    68 AIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVAN 132
            |:|:|..|..|.....:..||..:.:.||||:|.|:.:.:.:.:..|::.||.|.|::.::::|.
pombe    80 ALKMIPFTPNNTSQTVRVQREALLGRLLRHPNICRVIDCIRTPACTYILFEYVPGGQLLEYILAR 144

  Fly   133 GRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKD-MNIKLADFGFSNHYEEGATLKT 196
            |::.|..|.....||::|:.|.|:..:||||||.|||||.:| ..:||.|||.||.|.:...|:|
pombe   145 GKLDEDLARSFAMQLINALVYLHKNFIVHRDLKIENVLLTQDSRQVKLIDFGLSNFYSKDDLLRT 209

  Fly   197 WCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFM 261
            :|||..:||||:.....|.||:.|:||||||:|.:|||.:|||..::..|.|::..||...|.::
pombe   210 YCGSLYFAAPELLDAKPYIGPEVDVWSLGVVIYVMVCGRVPFDDVSVPMLHSKIKSGKLEFPSYI 274

  Fly   262 SQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQEQERFGDMSPGSGTVSKSASTSSLGS 326
            |::|..||..||.|.|.:|.:::|..|..||        ::..|....|  ..::...||.|:.|
pombe   275 SEDCCSLIAAMLNVNPRKRCSLEQAAKFPWL--------KKNSFCLYLP--IPLTSIPSTPSIRS 329

  Fly   327 ASDSPP-QLDSVVMTH---MLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKLQQRRRENQRLQ 387
            ....|| .|..:.:.|   :..:|.|..::....: |::..::..:|.|..:.|....|....|.
pombe   330 HVFKPPFNLKVLQLLHEHGLASIPELKHELYMAYI-ERKTTSLVCLYLLGVESLAPALRIPTALP 393

  Fly   388 HHASLAYSR-SRKTSITTGVVDRSEPV 413
            .    .||| .|..|...|.:|.:|.:
pombe   394 P----VYSRHQRHHSEILGAMDLTEKI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 101/252 (40%)
S_TKc 41..292 CDD:214567 101/251 (40%)
UBA_SIK 335..380 CDD:270523 7/47 (15%)
ppk25NP_596657.1 STKc_Kin1_2 51..305 CDD:270979 102/253 (40%)
S_TKc 53..305 CDD:214567 101/251 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5061
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.