DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik3 and Smok2b

DIOPT Version :9

Sequence 1:NP_001188969.1 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster
Sequence 2:NP_001161385.1 Gene:Smok2b / 236574 MGIID:3037705 Length:484 Species:Mus musculus


Alignment Length:478 Identity:133/478 - (27%)
Similarity:216/478 - (45%) Gaps:108/478 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFREIAILKSLRHPHITRLYE 105
            |.:.:|||.|..:.|.||.:.:|.:.||:|:|.|   :|.:.|....|:.:|....||:|..|.:
Mouse     8 YVMLETIGHGGCSKVMLARHRLTGSHVAVKMIRK---SECWCNPVMSEVELLMMADHPNIISLLQ 69

  Fly   106 VMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVL 170
            |:|::..:||:.|......::.|:...|.::|.||..:|.||:||::|||.:|:||||||.:|::
Mouse    70 VIETKKKVYLIMELCEGKSLYQHIRNAGYLQEDEARALFKQLLSAMNYCHNQGIVHRDLKPDNIM 134

  Fly   171 LDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGA 235
            ::||..:|:.|||.....:.|..|..:||:.|::||||.....|||||.|:|:||||||.:|.|.
Mouse   135 VEKDGKVKIIDFGLGTQVKPGQKLNLFCGTYPFSAPEVLLSRPYDGPKIDVWTLGVVLYFMVTGK 199

  Fly   236 LPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQ 300
            :|||..:|.:|..:::.||:.:|..:|.|...||..::...|..|.|:.:::.|.|::|      
Mouse   200 VPFDAASIQKLVRQILAGKYFVPSRLSVELRDLISLLMTANPKLRPTVAEVMVHPWVTE------ 258

  Fly   301 EQERFGDMSPGSGTVSKSASTSSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNI 365
                      |||...        ....:..|...:..:...:...|..|..|..|:.:::|:..
Mouse   259 ----------GSGVFP--------DPCEEQMPLKPNPAIVKAMGYIGFQAQDIEDSLRQRKFNET 305

  Fly   366 YAIYNLLHDKLQQ-------------------------------RRRENQRLQHHASLAYSRSRK 399
            .|.|.||..::.:                               ||||.:    ..||..|.:|:
Mouse   306 MASYCLLKKQILKECDRPIRAQPMNPSVTPFPSLVDTSTFHLGLRRRETE----PTSLRLSANRQ 366

  Fly   400 TSITTGVVDRSEPVKQESLDRLSPLSNANASSSALGFGWSDVAVDLEKYGDFELECLARSNDPPV 464
            .|    |..||...|:   ||              .|.|..|                  :..|:
Mouse   367 MS----VCGRSTSKKR---DR--------------RFSWPSV------------------SGRPL 392

  Fly   465 NAQHLSAHAGGGVNGANTRRHTV 487
            :..|...|       .:||..:|
Mouse   393 HTTHTMDH-------THTRTRSV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik3NP_001188969.1 PKc_like 40..292 CDD:304357 94/250 (38%)
S_TKc 41..292 CDD:214567 94/250 (38%)
UBA_SIK 335..380 CDD:270523 9/75 (12%)
Smok2bNP_001161385.1 STKc_AMPK-like 7..255 CDD:270905 94/249 (38%)
S_TKc 8..256 CDD:214567 94/250 (38%)
UBA_MARK_Par1 275..314 CDD:270522 9/38 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..400 16/82 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.