| Sequence 1: | NP_523786.2 | Gene: | edl / 37149 | FlyBaseID: | FBgn0023214 | Length: | 177 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524461.2 | Gene: | pnt / 42757 | FlyBaseID: | FBgn0003118 | Length: | 718 | Species: | Drosophila melanogaster |
| Alignment Length: | 53 | Identity: | 18/53 - (33%) |
|---|---|---|---|
| Similarity: | 27/53 - (50%) | Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 103 DPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVP 155 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| edl | NP_523786.2 | SAM_PNT-Mae | 103..170 | CDD:176086 | 18/53 (34%) |
| pnt | NP_524461.2 | SAM_PNT-ETS-1,2 | 179..250 | CDD:188879 | 18/53 (34%) |
| ETS | 609..693 | CDD:197710 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||