DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment edl and Ets65A

DIOPT Version :9

Sequence 1:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:83 Identity:22/83 - (26%)
Similarity:34/83 - (40%) Gaps:5/83 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TKYAGRVPPLDLTQVNGGQDLWGGNGGGNNASARRHLHHPYQMLDKCRGGVTLISASSAISSTSN 72
            |..||:|....|..|:....|     ....||:..|:.|..:.........|..|.::|.||:|:
  Fly   166 TSSAGQVTSGTLDAVSAAPAL-----PSLTASSSSHVEHKVRADKSTLDCATTSSHAAAPSSSSS 225

  Fly    73 SSDDNNNRLMSADDGTTS 90
            :||....|:..:....||
  Fly   226 ASDHQQGRISGSKSSNTS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086
Ets65ANP_001303373.1 ETS 316..401 CDD:197710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.