DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment edl and Elf3

DIOPT Version :10

Sequence 1:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001019939.1 Gene:Elf3 / 304815 RGDID:1310687 Length:395 Species:Rattus norvegicus


Alignment Length:58 Identity:12/58 - (20%)
Similarity:27/58 - (46%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSL-DMYLCRVPVGGKM 160
            |:.|::..|..|:.........:.::....:..|:|..||..:| ::.|...|:|.::
  Rat    87 PQFWSKTQVLDWISYQVEKNKYDASSIDFSRCDMDGATLCNCALEELRLVFGPLGDQL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086 12/58 (21%)
Elf3NP_001019939.1 SAM_PNT-ESE-1-like 78..155 CDD:188880 12/58 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..275
ETS 296..383 CDD:197710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.