DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment edl and ets1

DIOPT Version :10

Sequence 1:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001429428.1 Gene:ets1 / 280651 ZFINID:ZDB-GENE-021115-5 Length:485 Species:Danio rerio


Alignment Length:86 Identity:25/86 - (29%)
Similarity:39/86 - (45%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TSNSSDDNNNRLMSADDGTTSLLHPLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQK 134
            |..|.:..:..|::...|.|.....|   .:|.|||:||...|.:|| ...|:|......:. .|
Zfish    83 TPGSKEMMSQALLATFSGFTREQQRL---SIPKDPREWTEGHVREWL-TWTVNEFSLKNVDF-HK 142

  Fly   135 FPMNGKALCLMSLDMYLCRVP 155
            |.|:|.:||.:..:.:|...|
Zfish   143 FSMDGASLCALGKERFLDLAP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086 18/53 (34%)
ets1NP_001429428.1 None

Return to query results.
Submit another query.