DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment edl and ELF3

DIOPT Version :10

Sequence 1:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_004424.3 Gene:ELF3 / 1999 HGNCID:3318 Length:371 Species:Homo sapiens


Alignment Length:120 Identity:24/120 - (20%)
Similarity:47/120 - (39%) Gaps:24/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SAISSTSNSSDDNNNRLMSADDGTTSLLHP---LGSDGLPL--------------------DPRD 106
            :|....||...:..:.:.|::|.|.:.:.|   .|:|.|.|                    .|:.
Human     2 AATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQF 66

  Fly   107 WTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSL-DMYLCRVPVGGKM 160
            |::..|..|:.........:.:|....:..|:|..||..:| ::.|...|:|.::
Human    67 WSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086 13/59 (22%)
ELF3NP_004424.3 SAM_PNT-ESE-1-like 53..132 CDD:188880 13/69 (19%)
9aaTAD 137..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..251
ETS 272..359 CDD:197710
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.