DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment edl and Etv6

DIOPT Version :10

Sequence 1:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_031987.3 Gene:Etv6 / 14011 MGIID:109336 Length:485 Species:Mus musculus


Alignment Length:40 Identity:11/40 - (27%)
Similarity:16/40 - (40%) Gaps:1/40 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LY-GVLHAGPRFMAQRKAYDLRKVIRVYNIVQVLINSVIF 82
            || |..|.....:.|.....|.|.|....:....||:::|
Mouse    36 LYRGTFHCFQSIIRQESVLGLYKGIGSPMMGLTFINAIVF 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086
Etv6NP_031987.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
SAM_PNT-Tel_Yan 57..124 CDD:176085 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..210
ETS 334..420 CDD:197710
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.