| Sequence 1: | NP_523786.2 | Gene: | edl / 37149 | FlyBaseID: | FBgn0023214 | Length: | 177 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031987.3 | Gene: | Etv6 / 14011 | MGIID: | 109336 | Length: | 485 | Species: | Mus musculus |
| Alignment Length: | 40 | Identity: | 11/40 - (27%) |
|---|---|---|---|
| Similarity: | 16/40 - (40%) | Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 LY-GVLHAGPRFMAQRKAYDLRKVIRVYNIVQVLINSVIF 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| edl | NP_523786.2 | SAM_PNT-Mae | 103..170 | CDD:176086 | |
| Etv6 | NP_031987.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | ||
| SAM_PNT-Tel_Yan | 57..124 | CDD:176085 | 5/19 (26%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 157..210 | ||||
| ETS | 334..420 | CDD:197710 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 440..485 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||