DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gint3 and UBX4

DIOPT Version :9

Sequence 1:NP_611356.1 Gene:Gint3 / 37148 FlyBaseID:FBgn0034372 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_013783.1 Gene:UBX4 / 855089 SGDID:S000004671 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:75/279 - (26%)
Similarity:118/279 - (42%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VKE-KADECIATLIRYLENLIKNPEEEKFCKIRMSNKIFSEKVRYVEGALDVLQAAGFNEVQIDG 242
            ||| .:|:.||.::|.:.....:.     .||::.:||...|....|..  .|:..|   :|...
Yeast   106 VKEMPSDQPIAPILRQMSGAAGDD-----FKIQVFSKIIEFKTIKDENL--TLENLG---IQEPS 160

  Fly   243 EPFLLWTKEQTEKDLDL----------PTLVEALKSSEIIPLELDRNIKVLLPSQACRVALPD-- 295
            ...|::......:.:..          ||:......:.:.|.||.:. .|.|||......:.|  
Yeast   161 SVRLIFNNTSHSEGISANSAIHPKQTPPTMTNPETVASLPPHELHKP-SVFLPSDEPLAVIKDQI 224

  Fly   296 ---EFYRLSPEEIKKEQQ-LRSEAIAQSQMLRTKAMREREEQRNL----RMYRYALVRVKFPNGL 352
               |.|.|:.|:.||.|: |.|:|......:.||.:|| :...||    :.....|:|||||:..
Yeast   225 EDEEDYELTVEQAKKYQKMLSSKAGTLGGPILTKRLRE-QSANNLPKKNKAISECLLRVKFPDRS 288

  Fly   353 FIQGTFNVYEKISDVFEFVQSCLADESLDFSLVSNSDGKLGDEDLEKTLYDCKLIPNTLLLFSAN 417
            .||..|...|.:..|:..|...|.||::.|:|..:...|...:|.:|.|.|.:....|:|||..|
Yeast   289 HIQIAFKPNEDMRTVYNVVSQFLIDENMPFTLNQSHPFKPLAKDDKKLLDDLEFGSKTMLLFETN 353

  Fly   418 -DTPAPLQTDINYLKEDLL 435
             ::..||      :|..||
Yeast   354 SNSNGPL------IKAHLL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gint3NP_611356.1 PUB_UBXD1 171..268 CDD:198418 19/99 (19%)
UBQ 341..414 CDD:294102 24/72 (33%)
UBX4NP_013783.1 Ubl_ASPSCR1_like 4..74 CDD:340522
UBX 277..351 CDD:197552 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.