DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gint3 and PUX1

DIOPT Version :9

Sequence 1:NP_611356.1 Gene:Gint3 / 37148 FlyBaseID:FBgn0034372 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_566815.1 Gene:PUX1 / 822350 AraportID:AT3G27310 Length:251 Species:Arabidopsis thaliana


Alignment Length:206 Identity:52/206 - (25%)
Similarity:93/206 - (45%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 LDLPTLVEALKSSEI----IPLELDRNIKVL-------LPSQACRV-ALPDEFYRLSPEEIKKEQ 309
            |::...:||..|::.    :..:|.|.::|.       .|||.... ...|:||..:|.:..:..
plant    16 LEITDSMEASSSAQAKIADMREKLGREVRVFETSSISQRPSQVSSADDESDDFYEFTPADFYRLL 80

  Fly   310 QLRSEAIAQSQMLRTKAMREREEQRNLRMYRYALVRVKFPNGLFIQGTFNVYEKISDVFEFVQSC 374
            ..:.|    .:.|:|:.:||.||.........|::||:||:...::.||:..|||..:.:.|:..
plant    81 ATKKE----DKSLKTRKIREAEEAARRSKLTKAVIRVRFPDNHTLEATFHPSEKIQGLIDLVKRV 141

  Fly   375 LADESLDFSLVSNSDGKLGDEDLEKTLYDCKLIPNTLLLFSANDTP-------APLQTDINYLKE 432
            :|...:.|.|.: :..|...:|..:..|....:|..::.|| ||.|       .|      ||.|
plant   142 VAHPDVPFYLYT-TPPKKQIKDFSQDFYSAGFVPGAIVYFS-NDQPKDDGGSSTP------YLNE 198

  Fly   433 DLLML--VQAM 441
            ::|.|  ::||
plant   199 EILSLKDLEAM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gint3NP_611356.1 PUB_UBXD1 171..268 CDD:198418 3/10 (30%)
UBQ 341..414 CDD:294102 18/72 (25%)
PUX1NP_566815.1 UBX2_UBXN9 109..181 CDD:340535 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.