DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gint3 and Aspscr1

DIOPT Version :9

Sequence 1:NP_611356.1 Gene:Gint3 / 37148 FlyBaseID:FBgn0034372 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_038943475.1 Gene:Aspscr1 / 691026 RGDID:1588666 Length:569 Species:Rattus norvegicus


Alignment Length:187 Identity:57/187 - (30%)
Similarity:89/187 - (47%) Gaps:18/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PTLVEALKSSEIIPLE----LDRNIKVLLPS-----QACRVALPDEFYRLSPEEIKKE-QQLRSE 314
            |:..:..|..|..|.|    :||:..|..|.     |.....:||||:.::.:::::. .||:||
  Rat   295 PSKPKKSKPGEEPPQEPEPPVDRDPVVCHPDLEDLLQPWPAEVPDEFFEVTVDDVRRRLAQLKSE 359

  Fly   315 -AIAQSQMLRTKAMREREEQRNLRMYRYALVRVKFPNGLFIQGTFNVYEKISDVFEFVQSCLADE 378
             ...:...|.|||.||.:.:..|..|....:||.||:...:||.|...|.:.|:.:||:|.|.:.
  Rat   360 RKRLEEAPLVTKAFREAQMKEKLERYPKVALRVLFPDRYILQGFFRPSETVGDLRDFVRSHLGNP 424

  Fly   379 SLDFSLVSNSDGKLGDEDLEKTLYDCKLIPNTLLLFSANDTPAPLQTDINYLKEDLL 435
            .|.|.|.. :..|:..:|...||:...|.|..|:.|.|.: |..|     ||:..||
  Rat   425 ELSFYLFI-APPKMVLDDHTLTLFQANLFPAALVHFGAEE-PTGL-----YLEPGLL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gint3NP_611356.1 PUB_UBXD1 171..268 CDD:198418 1/7 (14%)
UBQ 341..414 CDD:294102 23/72 (32%)
Aspscr1XP_038943475.1 Ubl_ASPSCR1_like 12..81 CDD:340522
UBX1_UBXN9 90..171 CDD:340595
UBX2_UBXN9 388..460 CDD:340535 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.