DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gint3 and Aspscr1

DIOPT Version :9

Sequence 1:NP_611356.1 Gene:Gint3 / 37148 FlyBaseID:FBgn0034372 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_081153.1 Gene:Aspscr1 / 68938 MGIID:1916188 Length:550 Species:Mus musculus


Alignment Length:167 Identity:52/167 - (31%)
Similarity:82/167 - (49%) Gaps:14/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LDRNIKVLLPS-----QACRVALPDEFYRLSPEEIKKE-QQLRSE-AIAQSQMLRTKAMREREEQ 333
            :||:..|..|.     |.....:||||:.::.:::::. .||:|| ...:...|.|||.||.:.:
Mouse   314 VDRDPVVYHPDLEDLLQPWPAEVPDEFFEVTVDDVRRRLAQLKSERKRLEEAPLVTKAFREAQMK 378

  Fly   334 RNLRMYRYALVRVKFPNGLFIQGTFNVYEKISDVFEFVQSCLADESLDFSLVSNSDGKLGDEDLE 398
            ..|..|....:||.||:...:||.|...|.:.|:.:||:|.|.:..|.|.|.. :..|:..:|..
Mouse   379 EKLERYPKVALRVLFPDRYILQGFFRPSETVGDLRDFVRSHLGNPELSFYLFI-APPKMVLDDHT 442

  Fly   399 KTLYDCKLIPNTLLLFSANDTPAPLQTDINYLKEDLL 435
            .||:...|.|..|:.|.|.: |..|     ||:..||
Mouse   443 LTLFQANLFPAALVHFGAEE-PTGL-----YLEPGLL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gint3NP_611356.1 PUB_UBXD1 171..268 CDD:198418
UBQ 341..414 CDD:294102 23/72 (32%)
Aspscr1NP_081153.1 TUG-UBL1 15..78 CDD:288347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..320 2/5 (40%)
Interaction with GLUT4. /evidence=ECO:0000269|PubMed:14562105 313..376 19/61 (31%)
UBQ 385..456 CDD:294102 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 496..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.