DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gint3 and CG33722

DIOPT Version :9

Sequence 1:NP_611356.1 Gene:Gint3 / 37148 FlyBaseID:FBgn0034372 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001027152.1 Gene:CG33722 / 3772658 FlyBaseID:FBgn0064126 Length:478 Species:Drosophila melanogaster


Alignment Length:167 Identity:42/167 - (25%)
Similarity:77/167 - (46%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 ELDRN-------IKVLLPSQACRVA----------LPDEFYRLSPEEIK---KEQQLRSEAIAQS 319
            |::.|       :|::.|.||...:          |||.|:.|:..::|   ::.:..|.....:
  Fly   271 EVEENPGRAPPVVKIIGPRQAVLFSLDESKKNANDLPDSFFDLTVNDLKMVLRDLKRTSSGDDDA 335

  Fly   320 QMLRTKAMREREEQR----NLRMYRYALVRVKFPNGLFIQGTFNVYEKISDVFEFVQSCLADESL 380
            .:|..| :||.|.|:    .|..|:..::|::||:...:||.|..:|.:|.|.:||:..|.....
  Fly   336 PLLTAK-LRELERQKAMLAKLNQYKDCVLRIQFPDRFVLQGMFKPHEPLSKVEDFVREFLVQPGE 399

  Fly   381 DFSLVSNSDGKL---GDEDLEKTLYDCKLIPNTLLLF 414
            .|.|.:....|:   |:     ||.:...:||.::.|
  Fly   400 QFHLFTIPPKKVLPSGE-----TLLELNFVPNAIVHF 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gint3NP_611356.1 PUB_UBXD1 171..268 CDD:198418
UBQ 341..414 CDD:294102 20/75 (27%)
CG33722NP_001027152.1 TUG-UBL1 8..71 CDD:288347
UBQ 360..429 CDD:294102 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.