DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30122 and RSPRY1

DIOPT Version :9

Sequence 1:NP_001163196.1 Gene:CG30122 / 37146 FlyBaseID:FBgn0050122 Length:1272 Species:Drosophila melanogaster
Sequence 2:XP_011521729.1 Gene:RSPRY1 / 89970 HGNCID:29420 Length:607 Species:Homo sapiens


Alignment Length:462 Identity:84/462 - (18%)
Similarity:147/462 - (31%) Gaps:131/462 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PVTPSRRQRRTRSMSRSPSPVQAAPVAAEPVLDTLEEEE--QPEDKTVPQPEPESEQPAAEPEPE 113
            ||.|.||.|......|....|....:....|:.||.::.  |.||..:.....:|........|.
Human    80 PVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDKRKLQNEDAYIGPCFHKSSTGIVVSLPG 144

  Fly   114 QSEPEEAEPAAAVTEDTTVNQAVNEESQPEPEEFDEKSETDDKQETIEEAVPAVVPQNEVADEPM 178
            .|..::..|.:.:|                   ..|.:|||:....:.:::..|:|    .::|:
Human   145 ISLSDQEPPYSMIT-------------------LHEMAETDEGWLDVVQSLIRVIP----LEDPL 186

  Fly   179 EEDHDAAPEEQEPTQTEEPVEEKPAESTVAEHQS-NGDSQKMDVDEEDSAAPKTAEETE------ 236
                  .|........|.|:..|.|...:.|..: ||     :|..:||:.|.....|.      
Human   187 ------GPAVITLLLDECPLPTKDALQKLTEILNLNG-----EVACQDSSHPAKHRNTSAVLGCL 240

  Fly   237 ------PAA----------------KPEDQPPERRKRSHSRSKSRSRSGSRSSKHRGSVGD---- 275
                  ||:                |.:..|........:..|....|.::.:....|:.|    
Human   241 AEKLAGPASIGLLSPGILEYLLQCLKLQSHPTVMLFALIALEKFAQTSENKLTISESSISDRLVT 305

  Fly   276 -----------KRESKAAA----------EERTVPEDEPTIEENKVGLSWLDSDLHLRIDPTTFA 319
                       ||:....|          |.|.:..::..:...:..|:..|...:|:|.|....
Human   306 LESWANDPDYLKRQVGFCAQWSLDNLFLKEGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLE 370

  Fly   320 SAKPLTSEIYSLIWSGARANYGVREGKVCFEVRLSEESVPENSHYFRDEPHVRGFRVGFSMPKSS 384
            :....:|      :...|..:.|..|...:||.:....|               .::|::...|.
Human   371 ARCDASS------FESVRCTFCVDAGVWYYEVTVVTSGV---------------MQIGWATRDSK 414

  Fly   385 LL------LGEAEHSFGY--CETGRKATQSEFTDYGKP-----YQLDDVIGCYLDLESEPCTINY 436
            .|      :|:.|:|..|  |   |:...  :....||     ::..|.:|..|||..:  .:.:
Human   415 FLNHEGYGIGDDEYSCAYDGC---RQLIW--YNARSKPHIHPCWKEGDTVGFLLDLNEK--QMIF 472

  Fly   437 TLNGEDL 443
            .|||..|
Human   473 FLNGNQL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30122NP_001163196.1 SAP 6..40 CDD:280251
SPRY_hnRNP 300..480 CDD:293942 32/157 (20%)
PHA02664 <529..659 CDD:177447
AAA_33 709..855 CDD:290396
NK 709..>836 CDD:302627
DUF1777 1033..>1104 CDD:285811
RSPRY1XP_011521729.1 SPRY_RING 390..510 CDD:293941 24/112 (21%)
RING-HC_RSPRY1 556..596 CDD:319480
RING-HC finger (C3HC4-type) 558..592 CDD:319480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.