DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30122 and Rnf123

DIOPT Version :9

Sequence 1:NP_001163196.1 Gene:CG30122 / 37146 FlyBaseID:FBgn0050122 Length:1272 Species:Drosophila melanogaster
Sequence 2:NP_001298081.1 Gene:Rnf123 / 84585 MGIID:2148796 Length:1320 Species:Mus musculus


Alignment Length:281 Identity:65/281 - (23%)
Similarity:108/281 - (38%) Gaps:76/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SHSRSKSRSRSGSRSSKHRGSVGDKRES-------------KAAAEERTVPEDEPTIEENKVGLS 303
            |.||...|..|.:..|:..|.|.:|..|             .|||..|. |.:...:.|:...|.
Mouse     9 SFSRKSYRLTSDAEKSRVTGIVQEKLLSDYLYRIFSPPDRGPAAATSRK-PLNFHNLPEHVDQLL 72

  Fly   304 WLDSD-------LHLRIDPTT--------FASAKPLTSEIYSLIWSGARANYG-------VREGK 346
            .:||:       :..|:.|:|        |.....:..::..:|   ..:|:|       |.:||
Mouse    73 QVDSEDNESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVI---GHSNFGTIRSTTCVYKGK 134

  Fly   347 VCFEVRLSEESVPE------NSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQ 405
            ..:||.:|.:.:.:      |..:.::|.                 :|:..:|:.|.....:...
Mouse   135 WVYEVLISSQGLMQIGWCTINCRFNQEEG-----------------VGDTHNSYAYDGNRVRKWN 182

  Fly   406 SEFTDYGKPYQLDDVIGCYLDLESEPCTINYTLNGEDLGVAFEFEKSILGEEGALFPHIVTKGYE 470
            ...|:|||.:...|::.|.:||:..  |:::.|||..||.|||.....||.  |.||        
Mouse   183 VTTTNYGKAWAAGDIVSCLIDLDDG--TLSFCLNGVSLGTAFENLSRGLGM--AYFP-------- 235

  Fly   471 YLVNFSDTEQLLVN-AERPTR 490
             .::.|..|.:..| ..||.|
Mouse   236 -AISLSFKESVAFNFGSRPLR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30122NP_001163196.1 SAP 6..40 CDD:280251
SPRY_hnRNP 300..480 CDD:293942 44/207 (21%)
PHA02664 <529..659 CDD:177447
AAA_33 709..855 CDD:290396
NK 709..>836 CDD:302627
DUF1777 1033..>1104 CDD:285811
Rnf123NP_001298081.1 SPRY_RNF123 123..250 CDD:293940 36/156 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..483
RING-HC_RNF123 1258..1298 CDD:319455
RING-HC finger (C3HC4-type) 1260..1297 CDD:319455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.