DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30122 and Rspry1

DIOPT Version :9

Sequence 1:NP_001163196.1 Gene:CG30122 / 37146 FlyBaseID:FBgn0050122 Length:1272 Species:Drosophila melanogaster
Sequence 2:NP_001346022.1 Gene:Rspry1 / 67610 MGIID:1914860 Length:576 Species:Mus musculus


Alignment Length:466 Identity:90/466 - (19%)
Similarity:148/466 - (31%) Gaps:169/466 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AEPVLDTLEEEEQPEDKTVPQPEPESE--QPAAEPE----PEQSEPEEAEPAAAVTEDTTVNQAV 136
            ||..:||  .::|.|:.|||..:..|:  .|...|.    |.:...::......|.:...|.:.:
Mouse    52 AEDNVDT--HQQQAENSTVPTADSRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTL 114

  Fly   137 NEESQPEPEE---FDEKSETDDKQETIEEAVPAVVPQNEVADEPMEEDHDAAPEEQEPTQTEEPV 198
            .:..|..|..   ..|.:|||:....:.:::..|:|    .::|:      .|........|.|:
Mouse   115 VDNDQEPPYSMITLHEMAETDEGWLDVVQSLIRVIP----LEDPL------GPAVITLLLDECPL 169

  Fly   199 EEKPAESTVAEHQS-NGDSQKMDVDEEDSAAPKTAEETEPAAKPEDQPPERRKRSHSRSKSRSRS 262
            ..|.|...:.|..: ||     :|..:||..|                          :|.|:.|
Mouse   170 PTKDALQKLTEILNLNG-----EVACQDSGHP--------------------------AKHRNTS 203

  Fly   263 ---GSRSSKHRG--SVG---------------------------DKRESKAAAEERTVPEDEPTI 295
               |..:.|..|  |:|                           ...|..|...|..:...|.:|
Mouse   204 AVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHPTVMLFALIALEKFAQTSENKLTISESSI 268

  Fly   296 EENKVGLS-WLDSDLHLRIDPTTFASAKPLTSEIYSLIWSGARANYGVREGKVCFEVRLSEESVP 359
            .:..|.|. |.|...:|:......|.            ||  ..|..::||:     :|:.|.|.
Mouse   269 SDRLVTLELWADDPDYLKRQVGFCAQ------------WS--LDNLFLKEGR-----QLTYEKVD 314

  Fly   360 EN-----------SHYFRDEPH-------------VR--------------------GFRVGFSM 380
            .|           |.|.:..||             ||                    ..::|::.
Mouse   315 LNNIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDTGVWYYEVTVVTSGVMQIGWAT 379

  Fly   381 PKSSLL------LGEAEHSFGY--CETGRKATQSEFTDYGKP-----YQLDDVIGCYLDLESEPC 432
            ..|..|      :|:.|:|..|  |   |:...  :....||     ::..|.:|..|||..:  
Mouse   380 RDSKFLNHEGYGIGDDEYSCAYDGC---RQLIW--YNARSKPHVHPCWKEGDTVGFLLDLNEK-- 437

  Fly   433 TINYTLNGEDL 443
            .:.:.|||..|
Mouse   438 QMIFFLNGNQL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30122NP_001163196.1 SAP 6..40 CDD:280251
SPRY_hnRNP 300..480 CDD:293942 41/202 (20%)
PHA02664 <529..659 CDD:177447
AAA_33 709..855 CDD:290396
NK 709..>836 CDD:302627
DUF1777 1033..>1104 CDD:285811
Rspry1NP_001346022.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..99 12/47 (26%)
SPRY_RING 359..479 CDD:293941 20/97 (21%)
RING-HC_RSPRY1 525..565 CDD:319480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.