DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30122 and RNF123

DIOPT Version :9

Sequence 1:NP_001163196.1 Gene:CG30122 / 37146 FlyBaseID:FBgn0050122 Length:1272 Species:Drosophila melanogaster
Sequence 2:NP_071347.2 Gene:RNF123 / 63891 HGNCID:21148 Length:1314 Species:Homo sapiens


Alignment Length:331 Identity:70/331 - (21%)
Similarity:120/331 - (36%) Gaps:87/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SHSRSKSRSRSGSRSSKHRGSVGDK-------------RESKAAAEERTVPEDEPTIEENKVGLS 303
            |.||...|..|.:..|:..|.|.:|             ..:..||..|. |.:...:.|:...|.
Human     9 SFSRKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRK-PLNFQNLPEHLDQLL 72

  Fly   304 WLDSD-------LHLRIDPTT--------FASAKPLTSEIYSLIWSGARANYG-------VREGK 346
            .:|::       :..|:.|:|        |.....:..::..:|   ..:|:|       |.:||
Human    73 QVDNEEEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVI---GHSNFGTIRSTTCVYKGK 134

  Fly   347 VCFEVRLSEESVPE-----NSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQS 406
            ..:||.:|.:.:.:     .|..|..|..|                |:..:|:.|.....:....
Human   135 WLYEVLISSQGLMQIGWCTISCRFNQEEGV----------------GDTHNSYAYDGNRVRKWNV 183

  Fly   407 EFTDYGKPYQLDDVIGCYLDLESEPCTINYTLNGEDLGVAFE-----------------FEKSI- 453
            ..|:|||.:...|::.|.:||:..  |:::.|||..||.|||                 |::|: 
Human   184 TTTNYGKAWAAGDIVSCLIDLDDG--TLSFCLNGVSLGTAFENLSRGLGMAYFPAISLSFKESVA 246

  Fly   454 --LGEEGALFPHIVTKGYEYLVNFSDTEQLLVNAERPTRKRRKPRKDEDKDKDDDKDDNDGEKWK 516
              .|.....:|   ..||..|.:....:  ||.|:|.....|.....|....:....|.:..||:
Human   247 FNFGSRPLRYP---VAGYRPLQDPPSAD--LVRAQRLLGCFRAVLSVELDPVEGRLLDKESSKWR 306

  Fly   517 VLDEAT 522
            :..:.|
Human   307 LRGQPT 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30122NP_001163196.1 SAP 6..40 CDD:280251
SPRY_hnRNP 300..480 CDD:293942 46/226 (20%)
PHA02664 <529..659 CDD:177447
AAA_33 709..855 CDD:290396
NK 709..>836 CDD:302627
DUF1777 1033..>1104 CDD:285811
RNF123NP_071347.2 SPRY_RNF123 123..250 CDD:293940 32/144 (22%)
zf-C3HC4_3 1250..1298 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.