DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and FKBP6

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_003593.3 Gene:FKBP6 / 8468 HGNCID:3722 Length:327 Species:Homo sapiens


Alignment Length:338 Identity:84/338 - (24%)
Similarity:147/338 - (43%) Gaps:59/338 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDGAPPASVSGDGQKAEEEDAEEECDILGNKQLIKRTIKK------APQDSFRRPIRGELVTVNF 92
            ||.||       ||...|..::...||.|::.::|..|::      ||..|         |.|.:
Human    13 GDDAP-------GQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDAS---------VLVKY 61

  Fly    93 TGKLDNGTVVENELNFQ-----CHVGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKE 152
            :|.|::.....:...|:     ..:|:...:.|:::.|..::.||:::......:.||:||... 
Human    62 SGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPP- 125

  Fly   153 GESEYLVPPDAHLTYEIELLDI----KYEEFADLKS-------FEILRKYGTRKKERANFFYKRS 206
                 |:||:..:.:||||||.    :.::|..|.:       .:.:.|....::|..|:.::::
Human   126 -----LIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQN 185

  Fly   207 EFTTAIHLYRRALDFLDNRDGDPDSEFDKEDLELSNSDTQTLLE-DRLIVYNNLAMTQIKIAAYD 270
            .|..|...|:|||..|..|...|:.              |.|:| .:|.|..||:.|.:|:....
Human   186 RFYDAKVRYKRALLLLRRRSAPPEE--------------QHLVEAAKLPVLLNLSFTYLKLDRPT 236

  Fly   271 AALQSVEHVLRCQPNNSKALYRKGRILEGKADTQGAIKLLQKVATLEPENRAVQSDLARLFIKAR 335
            .||...|..|.....|:|||:|.|:......:.|.|...|.:....:|.|..:.::|.:|....|
Human   237 IALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASCYR 301

  Fly   336 REEHNEKEMYQKM 348
            .....||||:.:|
Human   302 DYVDKEKEMWHRM 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 20/96 (21%)
TPR_11 196..284 CDD:290150 24/88 (27%)
TPR repeat 196..220 CDD:276809 7/23 (30%)
TPR repeat 252..282 CDD:276809 10/29 (34%)
TPR_11 255..318 CDD:290150 18/62 (29%)
TPR repeat 287..313 CDD:276809 8/25 (32%)
TPR repeat 321..349 CDD:276809 8/28 (29%)
FKBP6NP_003593.3 FKBP_C 51..140 CDD:306713 23/103 (22%)
TPR <164..315 CDD:223533 44/165 (27%)
TPR 1 171..204 9/32 (28%)
TPR 2 219..252 10/32 (31%)
TPR repeat 221..247 CDD:276809 8/25 (32%)
TPR repeat 252..282 CDD:276809 9/29 (31%)
TPR 3 253..286 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.