DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and AT1G20810

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_173504.1 Gene:AT1G20810 / 838672 AraportID:AT1G20810 Length:232 Species:Arabidopsis thaliana


Alignment Length:60 Identity:17/60 - (28%)
Similarity:25/60 - (41%) Gaps:14/60 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDI 174
            |.:.:|       ::||....|.|....|||..|:.:       :||.|.....||||.:
plant   180 YFITEG-------MKVGGKRTVIVPPEAGYGQKGMNE-------IPPGATFELNIELLRV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 15/56 (27%)
Spy 196..>338 CDD:443119
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
AT1G20810NP_173504.1 FKBP_C 105..223 CDD:459735 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.