DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and PnsL4

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_568067.1 Gene:PnsL4 / 830126 AraportID:AT4G39710 Length:217 Species:Arabidopsis thaliana


Alignment Length:105 Identity:27/105 - (25%)
Similarity:52/105 - (49%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGELVTVNFTGKLDNGTVVENE------LNFQCHVGDYEVIQGLDMVL------PMLQVGEVSQV 136
            ||.||.:::|.:..:||:.::.      |..:..||  :||:|||..:      |.::||...::
plant   111 RGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVG--KVIRGLDQGILGGEGVPPMRVGGKRKL 173

  Fly   137 SVDSRFGYGSLGLKKEG--ESEYLVPPDAHLTYEIELLDI 174
            .:..:..||.   :..|  ..:..:|.:|.|.|:|..::|
plant   174 QIPPKLAYGP---EPAGCFSGDCNIPGNATLLYDINFVEI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 26/101 (26%)
Spy 196..>338 CDD:443119
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
PnsL4NP_568067.1 FKBP_C 106..205 CDD:459735 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.