DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbp11

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_077131.2 Gene:Fkbp11 / 66120 MGIID:1913370 Length:201 Species:Mus musculus


Alignment Length:186 Identity:40/186 - (21%)
Similarity:71/186 - (38%) Gaps:49/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EEDAEEECDILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELN---FQCHV 112
            |...|.|..:   :.|...|:.:.|:........|:.:.:::||.|.:|.:::..|.   ....:
Mouse    26 EAGPETESPV---RTLQVETLVQPPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIEL 87

  Fly   113 GDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIKYE 177
            |..:||.||:..|..:.|||..:..:.|...||..|....      :|.||.:.|::||:.:   
Mouse    88 GQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPS------IPADAVVQYDVELIAL--- 143

  Fly   178 EFADLKSFEILRKYGTRKKERANFFYKRSEFTTAI---------------HLYRRA 218
                               .|||::.|..:....:               ||||:|
Mouse   144 -------------------IRANYWQKLLKSILPLVGIAMVPALLGLIGYHLYRKA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 24/94 (26%)
TPR_11 196..284 CDD:290150 9/38 (24%)
TPR repeat 196..220 CDD:276809 9/38 (24%)
TPR repeat 252..282 CDD:276809
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Fkbp11NP_077131.2 FKBP_C 50..141 CDD:278674 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.