DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and FKBP7

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens


Alignment Length:217 Identity:53/217 - (24%)
Similarity:86/217 - (39%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QKAEEEDAEEECDILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELNFQCH 111
            ||.||...|.:.::|...:...:|.||           |:|:..::.|.|     .::...|.|.
Human    26 QKKEESTEEVKIEVLHRPENCSKTSKK-----------GDLLNAHYDGYL-----AKDGSKFYCS 74

  Fly   112 ------------VGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAH 164
                        :|..:||:|||:.:..:..||..:|.:...|.||     |||.:|..:||||.
Human    75 RTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG-----KEGYAEGKIPPDAT 134

  Fly   165 LTYEIELLDIKYEEFADLKSFEILRKYGTRKKERANFFYKRSEFTTAIHLYRRALDFLDNRDGDP 229
            |.:||||                   |...|..|:...:|:.:......|.:..::....|    
Human   135 LIFEIEL-------------------YAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQR---- 176

  Fly   230 DSEFDKEDLELSNSDTQTLLED 251
              ||:|::.....|....:|||
Human   177 --EFEKDEKPRDKSYQDAVLED 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 30/103 (29%)
TPR_11 196..284 CDD:290150 11/56 (20%)
TPR repeat 196..220 CDD:276809 3/23 (13%)
TPR repeat 252..282 CDD:276809 53/217 (24%)
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
FKBP7NP_851939.1 FKBP_C 46..141 CDD:306713 32/115 (28%)
EF-hand_7 152..214 CDD:316058 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.