Sequence 1: | NP_001286579.1 | Gene: | zda / 37144 | FlyBaseID: | FBgn0034368 | Length: | 397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003471.1 | Gene: | fkbp14 / 445077 | ZFINID: | ZDB-GENE-040801-210 | Length: | 211 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 83/196 - (42%) | Gaps: | 44/196 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 RRPIRGELVTVNFTGKLD-NGTVVENELNFQCHVGD----------YEVIQGLDMVLPMLQVGEV 133
Fly 134 SQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK-----YEEFADLKSFEILRKYGT 193
Fly 194 RKKERANFFYKRSEFTTAIHLYRRALDFLDNRDGDPDSEFDKEDL-ELSNSDTQTLLEDRLIVYN 257
Fly 258 N 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zda | NP_001286579.1 | FKBP_C | 80..172 | CDD:278674 | 29/102 (28%) |
TPR_11 | 196..284 | CDD:290150 | 15/64 (23%) | ||
TPR repeat | 196..220 | CDD:276809 | 8/23 (35%) | ||
TPR repeat | 252..282 | CDD:276809 | 2/7 (29%) | ||
TPR_11 | 255..318 | CDD:290150 | 1/4 (25%) | ||
TPR repeat | 287..313 | CDD:276809 | |||
TPR repeat | 321..349 | CDD:276809 | |||
fkbp14 | NP_001003471.1 | FKBP_C | 38..132 | CDD:278674 | 29/102 (28%) |
EF-hand_7 | 141..204 | CDD:290234 | 16/78 (21%) | ||
EFh | 142..204 | CDD:298682 | 16/77 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |