DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbpl

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001002818.1 Gene:Fkbpl / 406168 RGDID:1303227 Length:347 Species:Rattus norvegicus


Alignment Length:225 Identity:53/225 - (23%)
Similarity:91/225 - (40%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIKYEEFA---DLKSFEILRKYG 192
            ||:::..::|         .::||...:..|.:    ...|..::.:.|.   |....|.:.|..
  Rat   155 GELTEKCLES---------MRQGEEAKIHLPGS----STPLAKLRLDSFTNGRDSWELEAVEKEA 206

  Fly   193 TRKKE--RANFFYKRSEFTTAIHLYRRALDFLDN--RDGDPDSEFDKEDLELSNSDTQTLLEDRL 253
            ..|:|  |....::......|...|.|||..|..  ..|.|                     :|.
  Rat   207 LAKEEHRRGTELFRAGNPQGAARCYGRALRLLLTLPPPGPP---------------------ERT 250

  Fly   254 IVYNNLAMTQIKIAAYDAALQSVEHVLRCQPNNSKALYRKGRILEGKADTQGAIKLLQKVATLEP 318
            |::.|||..|:.:.....|.||.:.||..:|.:.|||||:|.......|...|...|:||..::|
  Rat   251 ILHANLAACQLLLGHPQLAAQSCDRVLEREPGHLKALYRRGVAQAALGDLDKATADLKKVLAVDP 315

  Fly   319 ENRAVQSDLARLFIKARREEHNEKEMYQKM 348
            :|||.:.:|.::.|:.:.::.......:||
  Rat   316 KNRAAKEELGKVVIQGKIQDAGLARGLRKM 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 6/40 (15%)
Spy 196..>338 CDD:443119 39/145 (27%)
TPR repeat 196..220 CDD:276809 6/25 (24%)
TPR repeat 252..282 CDD:276809 11/29 (38%)
TPR repeat 287..313 CDD:276809 9/25 (36%)
TPR repeat 321..349 CDD:276809 6/28 (21%)
FkbplNP_001002818.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
TPR 1 208..241 9/32 (28%)
TPR repeat 208..236 CDD:276809 7/27 (26%)
TPR 212..>336 CDD:440225 38/144 (26%)
TPR repeat 249..279 CDD:276809 11/29 (38%)
TPR 2 250..283 11/32 (34%)
TPR 3 284..317 12/32 (38%)
TPR repeat 284..312 CDD:276809 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.