DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbp12

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:106 Identity:35/106 - (33%)
Similarity:60/106 - (56%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 APQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVGEVS 134
            ||.|....|..|:.|||::||.||:||..::..:    |:..:|..|||:|.|..:..|.||:.:
  Fly     9 APGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRA 73

  Fly   135 QVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK 175
            ::.....:.|||.|      ...::||::.||:::|||.::
  Fly    74 KLICSPDYAYGSRG------HPGVIPPNSTLTFDVELLKVE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 30/95 (32%)
Spy 196..>338 CDD:443119
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 35/103 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.