DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbp12

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:106 Identity:35/106 - (33%)
Similarity:60/106 - (56%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 APQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVGEVS 134
            ||.|....|..|:.|||::||.||:||..::..:    |:..:|..|||:|.|..:..|.||:.:
  Fly     9 APGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRA 73

  Fly   135 QVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK 175
            ::.....:.|||.|      ...::||::.||:::|||.::
  Fly    74 KLICSPDYAYGSRG------HPGVIPPNSTLTFDVELLKVE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 30/95 (32%)
TPR_11 196..284 CDD:290150
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Fkbp12NP_523792.2 FkpA <2..107 CDD:223619 35/103 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.