DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbp10

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038942330.1 Gene:Fkbp10 / 360627 RGDID:1549751 Length:620 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:58/119 - (48%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQ 119
            |:...|..::....:.|||..||.:.|:.:..::.|.|.:||:.::..:    :..:||...:|.
  Rat   298 DVHNPKDTVQLETLELPQDCVRRAVAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYVGQGYIIP 362

  Fly   120 GLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLD 173
            |:|..|....:||..:::|.....||..|   .|:.   :|..|.|.:::.::|
  Rat   363 GMDQGLQGACIGERRRITVPPHLAYGENG---TGDK---IPGSAVLIFDVHVID 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 23/95 (24%)
TPR_11 196..284 CDD:290150
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Fkbp10XP_038942330.1 FKBP_C 54..146 CDD:395196
FKBP_C 166..297 CDD:395196
FKBP_C 317..409 CDD:395196 23/97 (24%)
FKBP_C 430..521 CDD:395196
EFh 544..605 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.