DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbp9

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001007647.1 Gene:Fkbp9 / 297123 RGDID:1549757 Length:570 Species:Rattus norvegicus


Alignment Length:228 Identity:48/228 - (21%)
Similarity:86/228 - (37%) Gaps:80/228 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ECDILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEV 117
            :|.:|..|                    |:.:..::...|.:||::::..|    :...:|..:|
  Rat   381 DCSVLSKK--------------------GDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGFGQV 425

  Fly   118 IQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDI-------- 174
            :.|:||.|..:.|||...|.:....|||..|:  :||    ||..|.|.::||||::        
  Rat   426 VLGMDMGLREMCVGEKRTVIIPPHLGYGEAGV--DGE----VPGSAVLVFDIELLELVSGLPEGY 484

  Fly   175 -----------KYEEFADLKSFEILRKYGTRKKERANFFYKRSEFTTAIHLY------RRALDF- 221
                       .:||.....:.|:|.:                ||:..||..      :.|..| 
  Rat   485 MFIWNGEVSPNLFEEIDKDGNGEVLLE----------------EFSEYIHAQVASGKGKLAPGFN 533

  Fly   222 --------LDNRDGDPDSEFDKEDLELSNSDTQ 246
                    ..|:|.:.|.:...|:.:|.:.:|:
  Rat   534 AEMIVKNMFTNQDRNGDGKVTAEEFKLKDQETK 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 27/95 (28%)
TPR_11 196..284 CDD:290150 12/66 (18%)
TPR repeat 196..220 CDD:276809 5/29 (17%)
TPR repeat 252..282 CDD:276809
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Fkbp9NP_001007647.1 FKBP_C 47..139 CDD:278674
FKBP_C 159..251 CDD:278674
FKBP_C 271..362 CDD:278674
FKBP_C 382..474 CDD:278674 30/117 (26%)
EF-hand_7 495..559 CDD:290234 14/79 (18%)
EFh 497..558 CDD:238008 14/76 (18%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 567..570 48/228 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.