DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and wis2

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_594787.1 Gene:wis2 / 2542541 PomBaseID:SPAC1B3.03c Length:356 Species:Schizosaccharomyces pombe


Alignment Length:349 Identity:73/349 - (20%)
Similarity:125/349 - (35%) Gaps:101/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDGAPPASVSGDGQKAEEEDAEEECDILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDN 98
            |:|....|:.  |:|.|:|:.|.:.|    |..:.......|..:..:.....:.|.:..||   
pombe    73 GNGTGGESIY--GEKFEDENFELKHD----KPFLLSMANAGPNTNGSQFFITTVPTPHLDGK--- 128

  Fly    99 GTVVENELNFQCHVGDYEVIQGL--------------DMVLPML--QVGEVSQVSVDSRFGYGSL 147
                        ||...:||||.              |.|:|::  :.|..::..:::       
pombe   129 ------------HVVFGKVIQGKSTVRTIENLETKNDDPVVPVVIEECGTCTKDQIEA------- 174

  Fly   148 GLKKEGESEYLVPPDAHLTYEIELLDIKYEEFAD----LKSFEILRKYGTRKKERANFFYKRSEF 208
                         |...:|.:      ..|||.|    .||...:.|..:..|..||..:.:...
pombe   175 -------------PKPDVTGD------SLEEFPDDYEGDKSETAIFKIASDLKGIANKQFAQQNL 220

  Fly   209 TTAIHLYRRALDFL-----DNRDGDPDSEFDKEDLELSNSDTQTLLEDRLIVYNNLAMTQIKIAA 268
            .||:..:::||.:|     .|.|.....:|.||...|           |..:|.|||:..:|...
pombe   221 DTAVAKWQKALRYLMEYPVPNDDSKESPDFWKEYNAL-----------RYSIYANLALVALKQNK 274

  Fly   269 YDAALQSVEHVLRCQPNNS------KALYRKGRILEGKADTQGAIKLL---QKVATLEPENRAVQ 324
            ...|:::...|:  :.:||      ||.||.|       ..||.:|..   :|.......:.|:.
pombe   275 PQEAIRNANIVI--EASNSTELEKQKAYYRLG-------CAQGLLKNFEESEKALAKAGNDPAIS 330

  Fly   325 SDLARLFIKARREEHNEKEMYQKM 348
            ..||.:..|.:..:..:::.|.||
pombe   331 KKLAEIRQKKKDYKKRQQKAYAKM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 15/107 (14%)
TPR_11 196..284 CDD:290150 22/92 (24%)
TPR repeat 196..220 CDD:276809 6/23 (26%)
TPR repeat 252..282 CDD:276809 8/29 (28%)
TPR_11 255..318 CDD:290150 18/71 (25%)
TPR repeat 287..313 CDD:276809 9/34 (26%)
TPR repeat 321..349 CDD:276809 7/28 (25%)
wis2NP_594787.1 cyclophilin 6..165 CDD:294131 23/112 (21%)
TPR_11 204..287 CDD:290150 22/95 (23%)
TPR repeat 204..253 CDD:276809 11/48 (23%)
TPR repeat 258..288 CDD:276809 8/31 (26%)
TPR_11 261..323 CDD:290150 18/70 (26%)
TPR repeat 293..323 CDD:276809 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.