DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and FKBP1B

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_004107.1 Gene:FKBP1B / 2281 HGNCID:3712 Length:108 Species:Homo sapiens


Alignment Length:106 Identity:27/106 - (25%)
Similarity:56/106 - (52%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 APQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVGEVS 134
            :|.|....|.:|:...|::||.|.||...::..:    |:..:|..|||:|.:.....:.:|:.:
Human     9 SPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRA 73

  Fly   135 QVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK 175
            :::......||:.|      ...::||:|.|.:::|||:::
Human    74 KLTCTPDVAYGATG------HPGVIPPNATLIFDVELLNLE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 23/95 (24%)
Spy 196..>338 CDD:443119
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
FKBP1BNP_004107.1 FKBP_C 13..105 CDD:459735 23/97 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.