DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and fkb-2

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001021722.1 Gene:fkb-2 / 173160 WormBaseID:WBGene00001427 Length:108 Species:Caenorhabditis elegans


Alignment Length:102 Identity:30/102 - (29%)
Similarity:57/102 - (55%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVGEVSQVS 137
            |:..:|..|:.||.::...|:||..:::..:    |:..:|..|||:|.|..:..:.|||.|:::
 Worm    12 DNVTKPKNGQTVTCHYVLTLENGKKIDSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSVGEKSKLT 76

  Fly   138 VDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDI 174
            :.:..|||..|:..:      :|.:|.|.:|:|||.:
 Worm    77 ISADLGYGPRGVPPQ------IPANATLVFEVELLGV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 27/95 (28%)
TPR_11 196..284 CDD:290150
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
fkb-2NP_001021722.1 FKBP_C 15..105 CDD:278674 27/95 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.