DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and fkb-5

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001367683.1 Gene:fkb-5 / 171974 WormBaseID:WBGene00001430 Length:300 Species:Caenorhabditis elegans


Alignment Length:152 Identity:39/152 - (25%)
Similarity:67/152 - (44%) Gaps:31/152 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GDGQKAEEEDAEEECDIL--------------GNKQ------LIKRTIKKAPQDSFRRPIRGELV 88
            |.|.|..|.|..:|...|              |.|.      :|::| .|..:|..::...|:.:
 Worm   147 GFGDKGRERDNIKEDQTLYYTVQLVDLFRAVPGEKWTTDEGIVIEQT-HKIDEDKCKKSKSGDTI 210

  Fly    89 TVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGL 149
            ...:...|::||.|::..:    |...:.:.|||:|:|:.:..:..||..||.:.|.||||.   
 Worm   211 HQQYVLHLEDGTFVDSSFSRNAPFIFKLNNNEVIKGMDIAMTGMCEGERRQVVIPSDFGYGD--- 272

  Fly   150 KKEGESEYLVPPDAHLTYEIEL 171
              :|.:. .:|..|.|.::|.|
 Worm   273 --DGRAP-AIPGKARLYFDITL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 26/96 (27%)
TPR_11 196..284 CDD:290150
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
fkb-5NP_001367683.1 FKBP_C 79..171 CDD:395196 7/23 (30%)
FKBP_C 202..291 CDD:395196 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.