DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and TTC9B

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_016881857.1 Gene:TTC9B / 148014 HGNCID:26395 Length:280 Species:Homo sapiens


Alignment Length:160 Identity:39/160 - (24%)
Similarity:54/160 - (33%) Gaps:50/160 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YKRSEFTTAIHLYRRALDFLDNRDG-----------DPDSE-------------FDKEDLELSNS 243
            |:..:|..||..|.|||..|....|           .|.|.             .:..::|..:|
Human    76 YREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPARLSEEQRRLVESTEVECYDS 140

  Fly   244 DTQTLLEDRLIVYNNLAMTQIKIAAYDAALQSVEHVLRCQPNNSKALYRKGRILEGKADTQGAIK 308
            .|..||:..|:.|..:....:|             ||..|..|.||.||.|.......|...|::
Human   141 LTACLLQSELVNYERVREYCLK-------------VLEKQQGNFKATYRAGIAFYHLGDYARALR 192

  Fly   309 LLQKVATLEPENRAVQSDLARLFIKARREE 338
            .||:..:.||             ..||||:
Human   193 YLQEARSREP-------------TVARREQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735
Spy 196..>338 CDD:443119 38/158 (24%)
TPR repeat 196..220 CDD:276809 7/16 (44%)
TPR repeat 252..282 CDD:276809 5/29 (17%)
TPR repeat 287..313 CDD:276809 9/25 (36%)
TPR repeat 321..349 CDD:276809 4/18 (22%)
TTC9BXP_016881857.1 TPR repeat 65..93 CDD:276809 7/16 (44%)
TPR repeat 134..166 CDD:276809 10/44 (23%)
TPR 145..>206 CDD:440225 20/86 (23%)
TPR repeat 171..197 CDD:276809 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.