DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and Fkbp12

DIOPT Version :10

Sequence 1:NP_611353.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_061517035.1 Gene:Fkbp12 / 1280504 VectorBaseID:AGAMI1_011056 Length:108 Species:Anopheles gambiae


Alignment Length:109 Identity:35/109 - (32%)
Similarity:60/109 - (55%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELN----FQCHVGDYEVIQGLDMVLPMLQVG 131
            |....|.:|.:|  |:...|::||.||:|||.::...    |:..||..|||:|.|..:..:.||
Mosquito     8 IANGDQTTFPKP--GQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGWDEGVAQMSVG 70

  Fly   132 EVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIK 175
            :.:::.....:.|||.|      ...::||:|.||:::|||.::
Mosquito    71 QRAKLVCSPDYAYGSRG------HPGVIPPNARLTFDVELLRVE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_611353.1 FKBP_C 80..172 CDD:459735 30/95 (32%)
Spy 196..>338 CDD:443119
TPR repeat 196..220 CDD:276809
TPR repeat 252..282 CDD:276809
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
Fkbp12XP_061517035.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.