DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zda and fkbp9

DIOPT Version :9

Sequence 1:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001123385.1 Gene:fkbp9 / 100125793 XenbaseID:XB-GENE-1019523 Length:585 Species:Xenopus tropicalis


Alignment Length:206 Identity:41/206 - (19%)
Similarity:83/206 - (40%) Gaps:60/206 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGELVTVNFTGKLDNGTVVENE----LNFQCHVGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGY 144
            :|:.:..::...|.:|||:::.    ..:...:|..:|:.|:|:.|..:.:||...:.:....||
 Frog   401 KGDYLKYHYNATLMDGTVLDSTHQYGKTYNIVLGSGQVVMGMDIGLQDMCIGEKRNIVIPPHLGY 465

  Fly   145 GSLGLKKEGESEYLVPPDAHLTYEIELLDI-------------------KYEEFADLKSFEILRK 190
            |..|:  |||    ||..|.|.::|||||:                   .:|:....::.|::  
 Frog   466 GEAGV--EGE----VPGSAVLVFDIELLDLIPGLPEGYMFVWNGEVSPNLFEDIDKDQNGEVV-- 522

  Fly   191 YGTRKKERANFFYKRSEFTTAIHLYRRA---------------LDFLDNRDGDPDSEFDKEDLEL 240
                          ..||...||...||               .:...|:|.:.|.:..:|:.:|
 Frog   523 --------------LDEFIEYIHAQVRAGKGKLAPGFDPNKIIENMFTNQDRNQDGKITEEEFKL 573

  Fly   241 SNSDTQTLLED 251
            .:.:.:.:.::
 Frog   574 KDEEDKEIHDE 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 25/91 (27%)
TPR_11 196..284 CDD:290150 11/71 (15%)
TPR repeat 196..220 CDD:276809 6/38 (16%)
TPR repeat 252..282 CDD:276809 41/206 (20%)
TPR_11 255..318 CDD:290150
TPR repeat 287..313 CDD:276809
TPR repeat 321..349 CDD:276809
fkbp9NP_001123385.1 FKBP_C 60..152 CDD:365980
FKBP_C 172..264 CDD:365980
FKBP_C 284..375 CDD:365980
FKBP_C 395..487 CDD:365980 25/91 (27%)
EFh 510..571 CDD:238008 12/76 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.