DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip55E and STR2

DIOPT Version :9

Sequence 1:NP_001286578.1 Gene:Eip55E / 37143 FlyBaseID:FBgn0000566 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_012664.1 Gene:STR2 / 853594 SGDID:S000003891 Length:639 Species:Saccharomyces cerevisiae


Alignment Length:421 Identity:97/421 - (23%)
Similarity:169/421 - (40%) Gaps:120/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSGFAT-------------KSIHSGQSPDQWKSAAVIPPISLSTTFKQDAPGEHRGYEYSRSGNP 58
            |||.|:             |.: |..|..|.|.....||...:..|         |:.|:    .
Yeast   299 PSGMASIFTAHRLLLNFDAKRL-SRSSSRQDKLIGYGPPFKKTVMF---------GFPYT----D 349

  Fly    59 TRNVLETCFAALDNAKYGLTFSSGLGATT---AVLTMLSSGDHIIMGDDVYGGTNRLIRQVATRL 120
            |.::|.         |:..|...|.|.:|   |:..:|.||:.|:                    
Yeast   350 TLSILR---------KFNHTHFLGQGDSTSMNALKNILHSGEQIL-------------------- 385

  Fly   121 GISATFVDPTKLDLIKSSIKPETKLVWIESPTNPLVKVADIEAIAQLVHGVREDI---VLAVDNT 182
                                    .|:||:|:|||:|:.|::.:.:|     .|:   .:.||.|
Yeast   386 ------------------------AVFIEAPSNPLLKMGDLQELKRL-----SDLYSFYIVVDET 421

  Fly   183 FLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMGGITMNSE-KLYK-SLKFLQNAVGIVPSPFDC 245
             :..:....:...||:||.||||..:|.::|:.|.:.:|.. |:|: :.||::...|..    ||
Yeast   422 -VGGFVNIDVLPYADIVCSSLTKIFSGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYE----DC 481

  Fly   246 Y---------QVNRSLKTLSLRMEQHQKNALKVAKYLETNPFVEKVLHPSLPSHPQHK-----IA 296
            .         :.:|.....::::..:....||.....:.....:|:.:|||.|....:     ::
Yeast   482 LWCEDALCLERNSRDFVERTIKVNTNTDILLKRVLLPQVGKLFKKIYYPSLTSEDTKRNYDSVMS 546

  Fly   297 LKQAYGYSGVFS--FYIKGELKHSSAFLKALKVFTLAESLGGYESLAELPSIMTHASVPAEDRKT 359
            .|.. ||.|:||  |:   .::.:..|...|:: ....|||...:||...:|:.|.. ..::...
Yeast   547 TKDG-GYGGLFSLTFF---NIEEAKKFFNNLEL-CKGPSLGTNFTLACPYAIIAHYQ-ELDEVAQ 605

  Fly   360 LGITDGLVRLSVGLEDADDLIKDLEQALEIA 390
            .|:...|||:|||||::|.|....::|:|.|
Yeast   606 YGVETNLVRVSVGLENSDVLCNVFQRAIEKA 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip55ENP_001286578.1 PRK08776 7..393 CDD:181554 97/421 (23%)
Cys_Met_Meta_PP 11..388 CDD:279402 92/413 (22%)
STR2NP_012664.1 MetC 203..637 CDD:223699 97/421 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.