DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip55E and YLL058W

DIOPT Version :9

Sequence 1:NP_001286578.1 Gene:Eip55E / 37143 FlyBaseID:FBgn0000566 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_013042.1 Gene:YLL058W / 850668 SGDID:S000003981 Length:575 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:85/360 - (23%)
Similarity:153/360 - (42%) Gaps:73/360 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SSGLGATTAVLTML-------SSGDHI-----------IMGDDV--YGGTNRLIRQVATRLGISA 124
            |||:.|.:....:|       :|||.:           ::.|.|  :|...:..:.:.|:.|...
Yeast   230 SSGMSAISTARNLLTFWEEKKNSGDSLNKTTSDQKKKPLLCDTVGIFGFPFKDTQVIMTKFGKCK 294

  Fly   125 TF-----VDPTKLDLIKSSIKPETKLVWIESPTNPLVKVADIEAIAQLVHGVREDIVLAVDNTF- 183
            .|     .|..:|.....:.|.....|::|:|:|||:.:.|::.:..|..  :....:.:|:|. 
Yeast   295 FFGFGNSRDVVELQKFLETSKQRILAVFVETPSNPLLNMPDLKKLRSLAD--QYGFFIVIDDTIG 357

  Fly   184 -----LTSYFQRPLELGADLVCYSLTKYMNGHTDVVMGGITMN-SEKLY------------KSLK 230
                 :..|        ||:|..||||..||.::|:.|.:.:| ...||            :.|.
Yeast   358 GLNVDILPY--------ADIVSTSLTKLFNGASNVMGGSVVLNPKSSLYPYAREYFRSANFEDLL 414

  Fly   231 FLQNAVGIVPSPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETNPFVEKVLHPSLPS---HPQ 292
            :.::|:.:..:       :|..:..:||...:....|......|.....:|:.:|::.|   ...
Yeast   415 WCEDAIVLERN-------SRDFEDRTLRANANTGILLNDLLLPEEGKICKKIYYPTVTSKETFEN 472

  Fly   293 HKIALKQAYGYSGVFS--FYIKGELKHSSAFLKALKVFTLAESLGGYESLAELPSI-MTHASVPA 354
            ::....:..||..:||  |:.:|:.|   ||..:||||. ..|.|...:|| .|.: :.|.| ..
Yeast   473 YESVRNERGGYGCLFSVAFFNEGDAK---AFYDSLKVFK-GPSNGTNFTLA-CPYVHLAHHS-EL 531

  Fly   355 EDRKTLGITDGLVRLSVGLEDADDLIKDLEQALEI 389
            |:....|....::|:||||||...|:|....||::
Yeast   532 EEVSKFGADPNIIRVSVGLEDIQWLLKVFSSALDV 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip55ENP_001286578.1 PRK08776 7..393 CDD:181554 85/360 (24%)
Cys_Met_Meta_PP 11..388 CDD:279402 84/357 (24%)
YLL058WNP_013042.1 MetC 117..568 CDD:223699 85/360 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.