DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip55E and MGL

DIOPT Version :9

Sequence 1:NP_001286578.1 Gene:Eip55E / 37143 FlyBaseID:FBgn0000566 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_176647.1 Gene:MGL / 842774 AraportID:AT1G64660 Length:441 Species:Arabidopsis thaliana


Alignment Length:385 Identity:118/385 - (30%)
Similarity:199/385 - (51%) Gaps:27/385 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HSGQSPDQWKSA--AVIPPISLSTTFKQDAPGEHRGYEYSRSGNPTRNVLETCFAALDNAKYGLT 78
            |.|.:.....||  .|:.|.::...|..:...::..|.|||..|||...|....|||:..:....
plant    57 HGGVNMSIEASATFTVMEPDTMRRMFTGELGPDNDFYVYSRHFNPTVLNLSRQMAALEGTQAAYC 121

  Fly    79 FSSGLGATTAVLTML-SSGDHIIMGDDVYGGTNRLIRQVATR-LGISATFVDPTKLDLIKSSI-K 140
            .|||:.|.::|:..| |||.|::....:||||:.|:.....| ..|:.:|||.|....:.::| :
plant   122 TSSGMSAISSVMLQLCSSGGHVVAASTLYGGTHALLSHFLPRTCNITTSFVDITDHGAVANAIVE 186

  Fly   141 PETKLVWIESPTNPLVKVADIEAIAQLVHGVREDIVLAVDNTFLTSYFQRPLELGADLVCYSLTK 205
            ..|::::.||..||.:.||||..::::.|  .:.:.:.|||||...... |.:||||:|.:|::|
plant   187 GRTQVLYFESVANPTLTVADIPELSRMAH--EKGVTVVVDNTFAPMVLS-PAKLGADVVVHSISK 248

  Fly   206 YMNGHTDVVMGGITMNSEKLYKSLKFLQNA----VGIVPSPFDCYQVNRSLKTLSLRMEQHQKNA 266
            :::|..|::.|.: ..||.|.|.:..|:..    :|...:....::::..:..|.|||.:|...|
plant   249 FISGGADIIAGAV-CGSENLVKEMMDLRGGSLMLLGPTMNAKVAFELSERIPHLGLRMREHSHRA 312

  Fly   267 LKVAKYLETNPFVEKVLHPSLPSHPQHKI---ALKQAYGYSGVFSFYIKGELKHSS--AFLK-AL 325
            ...|:.:  .....||::|.|.:|||||:   .:.:.|||.|:.|..::.|.|.:.  |:|: |.
plant   313 QVYAERM--RDLGMKVIYPGLETHPQHKLFKGMVNRDYGYGGLLSIDMETEEKANKLMAYLQNAT 375

  Fly   326 KVFTLAESLGGYESLAELPSIMTHASVPAEDRKTLGITDGLVRLSVGLEDADDLIKDLEQ 385
            :...:|.|||.||:|.......|.:.:....::..||:.||||:|||      .:..|||
plant   376 QFGFMAVSLGYYETLMSCSGSSTSSELDPSQKEAAGISPGLVRMSVG------YVGTLEQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip55ENP_001286578.1 PRK08776 7..393 CDD:181554 118/385 (31%)
Cys_Met_Meta_PP 11..388 CDD:279402 118/385 (31%)
MGLNP_176647.1 PLN02242 26..441 CDD:215134 118/385 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62407
OrthoDB 1 1.010 - - D572061at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.