DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip55E and CBL

DIOPT Version :9

Sequence 1:NP_001286578.1 Gene:Eip55E / 37143 FlyBaseID:FBgn0000566 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_191264.1 Gene:CBL / 824872 AraportID:AT3G57050 Length:464 Species:Arabidopsis thaliana


Alignment Length:361 Identity:162/361 - (44%)
Similarity:241/361 - (66%) Gaps:3/361 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVIPPISLSTTFKQDAPGEHRGYEYSRSGNPTRNVLETCFAALDNAKYGLTFSSGLGATTAVLTM 92
            |:..|:..:.||||.:..|:..|:|:|||||||:.||:..|.||.|.....|:||:.|.:||..:
plant   103 AMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFCFTSGMAALSAVTHL 167

  Fly    93 LSSGDHIIMGDDVYGGTNRLIRQVATRLGISATFVDPTKLDLIKSSIKPETKLVWIESPTNPLVK 157
            :.:|:.|:.|||||||::||:.||..|.|:....|:.||||.:.::|.|:|||||:||||||..:
plant   168 IKNGEEIVAGDDVYGGSDRLLSQVVPRSGVVVKRVNTTKLDEVAAAIGPQTKLVWLESPTNPRQQ 232

  Fly   158 VADIEAIAQLVHGVREDIVLAVDNTFLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMGGITMNS 222
            ::||..|:::.|.  :..::.|||:.::....||||||||:|.:|.||::.||:||:.|.:.:..
plant   233 ISDIRKISEMAHA--QGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVKG 295

  Fly   223 EKLYKSLKFLQNAVGIVPSPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETNPFVEKVLHPSL 287
            |||.|.:.||||:.|...:||||:...|.:||::||:|:.|:||.|:|.||.::|.|:||.:..|
plant   296 EKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKKVYYAGL 360

  Fly   288 PSHPQHKIALKQAYGYSGVFSFYIKGELKHSSAFLKALKVFTLAESLGGYESLAELPSIMTHASV 352
            |.||.|.:...||.|...|||| |.|.:..|...::..|.|::|.|.|..:||..:|..|:|||:
plant   361 PDHPGHHLHFSQAKGAGSVFSF-ITGSVALSKHLVETTKYFSIAVSFGSVKSLISMPCFMSHASI 424

  Fly   353 PAEDRKTLGITDGLVRLSVGLEDADDLIKDLEQALE 388
            |||.|:..|:|:.|||:|.|:||.||||.||:.|.:
plant   425 PAEVREARGLTEDLVRISAGIEDVDDLISDLDIAFK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip55ENP_001286578.1 PRK08776 7..393 CDD:181554 162/361 (45%)
Cys_Met_Meta_PP 11..388 CDD:279402 162/359 (45%)
CBLNP_191264.1 PLN02509 1..464 CDD:178125 162/361 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 321 1.000 Domainoid score I275
eggNOG 1 0.900 - - E1_COG0626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I702
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D572061at2759
OrthoFinder 1 1.000 - - FOG0002609
OrthoInspector 1 1.000 - - oto3677
orthoMCL 1 0.900 - - OOG6_100353
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1714
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.