DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and UBA3

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_003959.3 Gene:UBA3 / 9039 HGNCID:12470 Length:463 Species:Homo sapiens


Alignment Length:351 Identity:79/351 - (22%)
Similarity:124/351 - (35%) Gaps:108/351 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 PDL-----NLEIISQT-KCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHA 388
            ||.     :|:.:..| |.|:.|||.|||.:.:||...||:.|.::|...:..||..||.|:...
Human    54 PDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPK 118

  Fly   389 DAVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKL-----VQ 448
            |.   .|.||..||:.|.:..|:...      :|                |...|:..     .|
Human   119 DI---GRPKAEVAAEFLNDRVPNCNV------VP----------------HFNKIQDFNDTFYRQ 158

  Fly   449 DHDVIFLLTDSRESRWLPTLLGAAKEKIVIN---AALGFDSYLVMRHGTTRKEAGDDGQEIEGLK 510
            .|.::..|......||:..:|.:     ::|   ..|...|.:.:..|.|....|:....:.|: 
Human   159 FHIIVCGLDSIIARRWINGMLIS-----LLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGM- 217

  Fly   511 CINGDQLGCYFCN------DVTAPGNSLKDRTLDQQCTV-TRPGVSNIAASYAVELLVALLQHPR 568
                  ..|..|.      .|..|           .||: :.|.:......|     |.:||.|:
Human   218 ------TACIECTLELYPPQVNFP-----------MCTIASMPRLPEHCIEY-----VRMLQWPK 260

  Fly   569 KELAPAYYAQSGRGRSEETEEKVPEGLLGIL--------PHSIRGMLCN-----YENILPATQK- 619
            ::       ..|.|...:.::  ||.:..|.        .::|||:...     .:.|:||... 
Human   261 EQ-------PFGEGVPLDGDD--PEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVAST 316

  Fly   620 ----FAQC------IACSAAV-LNEY 634
                .|.|      ||.||.: ||.|
Human   317 NAVIAAVCATEVFKIATSAYIPLNNY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 79/351 (23%)
Apg7 341..658 CDD:238763 75/334 (22%)
UBA3NP_003959.3 Interaction with UBE2M N-terminus 53..70 3/15 (20%)
Uba3_RUB 71..368 CDD:238765 75/334 (22%)
Interaction with UBE2M N-terminus 157..161 1/3 (33%)
Interaction with UBE2M N-terminus 192..217 4/24 (17%)
Interaction with NEDD8 227..229 0/1 (0%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 242..248 1/5 (20%)
Interaction with NAE1. /evidence=ECO:0000269|PubMed:12740388 292..295 0/2 (0%)
Interaction with UBE2M N-terminus 331..338 4/6 (67%)
Interaction with NEDD8 352..357
Interaction with UBE2M core domain 368..463
E2_bind 376..461 CDD:400951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.