DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and UBA4

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_011979.1 Gene:UBA4 / 856511 SGDID:S000001153 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:364 Identity:78/364 - (21%)
Similarity:129/364 - (35%) Gaps:113/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 ISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTA 401
            :..||.|:.|||.|||.....|...|...|.::|:..|..||..||.|:   |:.....:|..:|
Yeast    65 LKNTKVLVVGAGGLGCPALPYLAGAGVGQIGIVDNDVVETSNLHRQVLH---DSSRVGMLKCESA 126

  Fly   402 AQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLP 466
            .|.:.::||......|.:.:                 :......:.:.::.|...|||..:|:| 
Yeast   127 RQYITKLNPHINVVTYPVRL-----------------NSSNAFDIFKGYNYILDCTDSPLTRYL- 173

  Fly   467 TLLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLG-CYFCNDVT-APG 529
                      |.:.|:.....:|...|     .|.:||    |..:|.:.:| ||.|...| .|.
Yeast   174 ----------VSDVAVNLGITVVSASG-----LGTEGQ----LTILNFNNIGPCYRCFYPTPPPP 219

  Fly   530 NSLKDRTLDQQCTVTRPGVSNIAASYAVELLVALLQ-HPRKELAPAYYAQSG-----------RG 582
            |::   |..|:..|..|.:..:....|||.|..:|. :..:..:|.....||           ||
Yeast   220 NAV---TSCQEGGVIGPCIGLVGTMMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKMRG 281

  Fly   583 RSEE----------TEEKVPEGLLGILPHSIRGMLCNYENILPATQKFAQCIACSAAVLNEYKKE 637
            |.|:          |:|.:.:|.:            |||            :.|.|...|..:. 
Yeast   282 RQEKCLCCGKNRTITKEAIEKGEI------------NYE------------LFCGARNYNVCEP- 321

  Fly   638 GHAFLFKTFETAKFLEDLTGISEFKRLNSEIIDFDDEEF 676
                           ::...:..|:|:      :.|:||
Yeast   322 ---------------DERISVDAFQRI------YKDDEF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 78/364 (21%)
Apg7 341..658 CDD:238763 72/340 (21%)
UBA4NP_011979.1 ThiF_MoeB_HesA_family 46..279 CDD:238386 60/256 (23%)
RHOD_ThiF 316..440 CDD:238784 6/46 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.