DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and AOS1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_015506.1 Gene:AOS1 / 856310 SGDID:S000006384 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:425 Identity:86/425 - (20%)
Similarity:158/425 - (37%) Gaps:138/425 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 MDPAKLAENSVNL-NLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLD 370
            |...||:|:.:.| :.::..|.:....|:.   ..|.||...|.:|..:.::::..|..|:|:||
Yeast     3 MKVEKLSEDEIALYDRQIRLWGMTAQANMR---SAKVLLINLGAIGSEITKSIVLSGIGHLTILD 64

  Fly   371 SGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAE---------------------- 413
             |.:.....:....:..::.|...::.||  .:|::::||..|                      
Yeast    65 -GHMVTEEDLGSQFFIGSEDVGQWKIDAT--KERIQDLNPRIELNFDKQDLQEKDEEFFQQFDLV 126

  Fly   414 --------------TAGYVLEIPMPGHTIGES-LLAQTKEHLKVIEKLVQDHDVIFLLTDSRESR 463
                          |....|.||:  :..|.: |.|..  .:.:||         |:..|.:...
Yeast   127 VATEMQIDEAIKINTLTRKLNIPL--YVAGSNGLFAYV--FIDLIE---------FISEDEKLQS 178

  Fly   464 WLPTLLG-AAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYF-CNDVT 526
            ..||.:| .:..:.:|..             ||||:..|:.:..|.:|..|     ||. .|:|.
Yeast   179 VRPTTVGPISSNRSIIEV-------------TTRKDEEDEKKTYERIKTKN-----CYRPLNEVL 225

  Fly   527 APGNSLKDRTLDQQCTVTRPGVSNIAASYAVELLVALLQHPRKELAPAYYAQSGRGRSEETEEKV 591
            :.. :||::...:|.    ..|::|     :.|.::|||          |..:.:|::...|:..
Yeast   226 STA-TLKEKMTQRQL----KRVTSI-----LPLTLSLLQ----------YGLNQKGKAISFEQMK 270

  Fly   592 PEGLLGILPHSIRGMLCNYENI-LPATQKFAQCIACSAAVLNEY-----KKEGHAFLFKTFETAK 650
            .:.          .:.|  ||: :|||           .|.::|     |::|..|.    ..|.
Yeast   271 RDA----------AVWC--ENLGVPAT-----------VVKDDYIQQFIKQKGIEFA----PVAA 308

  Fly   651 FL-----EDLTGISEFKRLN--SEIIDFDDEEFDM 678
            .:     :|:..|.. |||:  :..|.||....||
Yeast   309 IIGGAVAQDVINILG-KRLSPLNNFIVFDGITLDM 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 86/425 (20%)
Apg7 341..658 CDD:238763 70/366 (19%)
AOS1NP_015506.1 Aos1_SUMO 13..345 CDD:238769 82/415 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.