DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and UBA1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_012712.1 Gene:UBA1 / 853670 SGDID:S000001693 Length:1024 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:60/267 - (22%)
Similarity:102/267 - (38%) Gaps:80/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 SLSSLDDK--NVEFCYFGFADPSEYEHPAWIMRNYAAFLLQQCPSFVGKPLKFLGLRHN----QQ 258
            |..||..:  |.||.   |:|.::::..|.:...:.|             |....:|||    :.
Yeast   265 SFKSLKQQLSNPEFV---FSDFAKFDRAAQLHLGFQA-------------LHQFAVRHNGELPRT 313

  Fly   259 MNIDDS--LVWKVIQTEACDLS-QSENIKFVGWELNK---------------------------- 292
            ||.:|:  |: |::    .||| |...:...|.::|:                            
Yeast   314 MNDEDANELI-KLV----TDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQE 373

  Fly   293 -----NGKMGP-RMVCMRDSM----DPAKLAENSVN---LNLKLMKWRLVPDLNLE-IISQTKCL 343
                 :||..| :.....||:    ||.....|...   :|.:......|..|:.: .|:.:|..
Yeast   374 VLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVF 438

  Fly   344 LFGAGTLGCAVARN--LLSWGF---KHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQ 403
            |.|:|.:||.:.:|  ||..|.   .:|.:.|:..:..||..||.|:...|.   .:.|:..||:
Yeast   439 LVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKDV---GKNKSEVAAE 500

  Fly   404 RLKEINP 410
            .:..:||
Yeast   501 AVCAMNP 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 28/145 (19%)
E1_like_apg7 11..682 CDD:273590 60/267 (22%)
Apg7 341..658 CDD:238763 23/75 (31%)
UBA1NP_012712.1 Ube1 13..1023 CDD:273603 60/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.