DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and UBA5

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_079094.1 Gene:UBA5 / 79876 HGNCID:23230 Length:404 Species:Homo sapiens


Alignment Length:295 Identity:58/295 - (19%)
Similarity:106/295 - (35%) Gaps:45/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 DLSQSENIKFVGWELNKNGKMGPRMVCMRDSMDPAKLAENSVNLNLKLMKWRLVPDLNLEIISQT 340
            :|:|..::     ::.::|..|...|.: :.|....:..|..:..:.|.:..:|.|  .|.|...
Human    18 ELAQERSL-----QVPRSGDGGGGRVRI-EKMSSEVVDSNPYSRLMALKRMGIVSD--YEKIRTF 74

  Fly   341 KCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTAAQRL 405
            ...:.|.|.:|...|..|...|...:.|.|..||..:|..|.....|...::    |...|...|
Human    75 AVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLS----KVQAAEHTL 135

  Fly   406 KEINPSA--ETAGY-VLEIPMPGHTIGESLLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPT 467
            :.|||..  |...| :..:....|.:........:|...|        |::....|:.|:|    
Human   136 RNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPV--------DLVLSCVDNFEAR---- 188

  Fly   468 LLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEG-LKCINGDQLGCYFCNDVTAPGNS 531
                    :.||.|..       ..|.|..|:|.....:.| ::.|...:..|:.|........:
Human   189 --------MTINTACN-------ELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAAN 238

  Fly   532 LKDRTLDQQ--CTVTRPGVSNIAASYAVELLVALL 564
            :.::||.::  |..:.|....:.|...|:.::..|
Human   239 IDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 5/26 (19%)
E1_like_apg7 11..682 CDD:273590 58/295 (20%)
Apg7 341..658 CDD:238763 46/230 (20%)
UBA5NP_079094.1 ThiF_MoeB_HesA_family 52..297 CDD:238386 51/255 (20%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000269|PubMed:26929408, ECO:0000269|PubMed:27653677 334..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.