DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba5

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_079968.2 Gene:Uba5 / 66663 MGIID:1913913 Length:403 Species:Mus musculus


Alignment Length:257 Identity:50/257 - (19%)
Similarity:89/257 - (34%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 RLVPDLNLEIISQTKCL------LFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLY 385
            ||:....:.|:|..|.:      :.|.|.:|...|..|...|...:.|.|..||..:|..|....
Mouse    53 RLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQ 117

  Fly   386 THADAVAGNRMKATTAAQRLKEINPSA--ETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKLV- 447
            .:...::    |...|...|:.|||..  |...|.:               .|.||.:.....: 
Mouse   118 PYQAGLS----KVHAAEHTLRNINPDVLFEVHNYNI---------------TTVEHFEHFMNRIS 163

  Fly   448 -------QDHDVIFLLTDSRESRWLPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQE 505
                   |..|::....|:.|:|            :.||.|..       ..|.|..|:|.....
Mouse   164 NGGLEEGQPVDLVLSCVDNFEAR------------MAINTACN-------ELGQTWMESGVSENA 209

  Fly   506 IEG-LKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQ--CTVTRPGVSNIAASYAVELLVALL 564
            :.| ::.:...:..|:.|.......:::.::||.::  |..:.|....:.|...|:.::..|
Mouse   210 VSGHIQLMIPGESACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 50/257 (19%)
Apg7 341..658 CDD:238763 46/243 (19%)
Uba5NP_079968.2 ThiF_MoeB_HesA_family 50..293 CDD:238386 50/257 (19%)
ThiF 51..307 CDD:279270 50/257 (19%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.