DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and mRpL36

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster


Alignment Length:132 Identity:26/132 - (19%)
Similarity:46/132 - (34%) Gaps:33/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 LYTHADAVAGNRMKATTAAQRLKEINPS---------AETAGYVLEIPMPGHTI-----GESLLA 434
            |:....|..|..:....||..:..|..|         .:|:|.:    .||.|:     |..:..
  Fly    14 LWNGLSAARGFHLLTRPAAPAIVSIQSSQLVAATTGICQTSGLL----TPGSTLVQQVAGFKVKG 74

  Fly   435 QTKEHLKVIEKLV-QDHDVIFLLTDSRESRWLPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKE 498
            :.|...|....:| |:...:...|..|..:.      :.|::       .:.|: ::.|.|..||
  Fly    75 RLKRRCKDCYIVVRQERGYVICPTHPRHKQM------SMKKR-------DYKSW-ILTHATQSKE 125

  Fly   499 AG 500
            .|
  Fly   126 RG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 26/132 (20%)
Apg7 341..658 CDD:238763 26/132 (20%)
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 6/34 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.