DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Sae1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_001272820.1 Gene:Sae1 / 56459 MGIID:1929264 Length:350 Species:Mus musculus


Alignment Length:309 Identity:64/309 - (20%)
Similarity:106/309 - (34%) Gaps:74/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 ENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSN 378
            |.:...:.::..|.|.....|.   .::.|:.|...||..:|:||:..|.|.:|:||..:|...:
Mouse    18 EEAAQYDRQIRLWGLEAQKRLR---ASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPED 79

  Fly   379 PVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVI 443
            |..|.| ....:|..||.:|  :.:|.:.:||..:                  :...|::..|..
Mouse    80 PGAQFL-IQTGSVGRNRAEA--SLERAQNLNPMVD------------------VKVDTEDVEKKP 123

  Fly   444 EKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVI--------NAALGFDSYLVMRHGTTRKEAG 500
            |......|.:.|...||:              ::|        |:...|...:...||.|....|
Mouse   124 ESFFTKFDAVCLTCCSRD--------------VIIKVDQICHRNSIKFFTGDVFGYHGYTFANLG 174

  Fly   501 DDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLD-QQCTVTR------PGVSNIAASYAVE 558
            :.....|..|.....|        ....|...|...|| .:.|:.:      |....:...::.|
Mouse   175 EHEFVEEKTKVAKVSQ--------GVEDGPEAKRAKLDSSETTMVKKKVLFCPVKEALEVDWSGE 231

  Fly   559 LLVALLQHPRKELAPAYY---------AQSGRGRSEETEEKVPEGLLGI 598
            ...|.|    |..||.|:         ...||..:.|:.::..|.||.|
Mouse   232 KAKAAL----KRTAPDYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 64/309 (21%)
Apg7 341..658 CDD:238763 60/282 (21%)
Sae1NP_001272820.1 Aos1_SUMO 20..345 CDD:238769 63/307 (21%)
ThiF 23..338 CDD:279270 63/304 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.