DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Aos1

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster


Alignment Length:333 Identity:75/333 - (22%)
Similarity:117/333 - (35%) Gaps:110/333 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 AENSVNLNLKLMKWRLVPDLNLEIISQTKCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKV--- 374
            |||.: .:.::..|.|.....|.   ..|.|:.|...||..:.:|::..|...:.|||...|   
  Fly    17 AENEL-YDRQIRLWGLESQKRLR---TAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEE 77

  Fly   375 ----GFSNPVRQNLYTHADAVAGNRMKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGES---- 431
                .|..| |::|.|       ||.:|:..  |.:.:||       :::|......:.|.    
  Fly    78 DFCSQFLVP-RESLNT-------NRAEASLT--RARALNP-------MVDISADREPLKEKTSEF 125

  Fly   432 --------LLAQTKEHLKVIEKLVQDHDVIFLLTDSRESRWLPTLLGAAKEKIVINAALGF---- 484
                    :...|.|.|..|:.:.:|..|.|:.||.    |               ...||    
  Fly   126 FGQFDVVVVNGATNEELLRIDTICRDLGVKFIATDV----W---------------GTFGFYFAS 171

  Fly   485 ---DSYL--VMRH---GTTRKEAGDDGQEIEGLKCINGDQLGCYFCNDVTAPGNSLKDRTLDQQC 541
               .||:  |::|   ..:.|:...:...|...:.::......:...|||.|....|.:.     
  Fly   172 LQKHSYVEDVIKHKVVANSEKKKKYETVSIPTQRDVDYPGYSAWLDFDVTEPSYLRKLKR----- 231

  Fly   542 TVTRPGVSNIAASYAVELLVALLQ-----HPRKELAPAYYAQSGRGRSEETEEKVPEGLLGI--- 598
              ..|||          ||:::||     |.|.   |:|          :|.|...|.|.||   
  Fly   232 --NGPGV----------LLLSVLQKFRTTHKRD---PSY----------KTREADLELLRGIRDE 271

  Fly   599 -LPHSIRG 605
             ||:||.|
  Fly   272 LLPNSILG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 75/333 (23%)
Apg7 341..658 CDD:238763 69/305 (23%)
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 40/192 (21%)
ThiF 22..>167 CDD:279270 37/183 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.