DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and uba3

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_998632.1 Gene:uba3 / 406776 ZFINID:ZDB-GENE-040426-2825 Length:462 Species:Danio rerio


Alignment Length:402 Identity:91/402 - (22%)
Similarity:138/402 - (34%) Gaps:131/402 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 MRDSMDPAKLAENSVNLNLKLM-------------KWRLV------------PDL-----NLEII 337
            |.:..:|.|.......||.|::             :|..|            ||.     :|:.:
Zfish     1 MAEGEEPEKKRRRIEELNEKMVVDGGSGDRSEWQGRWDHVRKFLERTGPFTHPDFEASTESLQFL 65

  Fly   338 SQT-KCLLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNRMKATTA 401
            ..| |.|:.|||.|||.:.::|...||:||.::|...:..||..||.|:                
Zfish    66 LDTCKILVIGAGGLGCELLKDLALSGFRHIHVVDMDTIDVSNLNRQFLF---------------- 114

  Fly   402 AQRLKEI-NPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKL-----VQDHDVIFLLTDSR 460
              |.|:: .|.||.|...:...:||.::        ..|.|.|:.|     .|.|.|:..|....
Zfish   115 --RPKDVGRPKAEVAADFVNDRVPGCSV--------VPHFKKIQDLDETFYRQFHIVVCGLDSVI 169

  Fly   461 ESRWLPTLLGAAKEKIVINAALGFDSYLVMRHGTTRKEAGDDGQEIEGLKCINGDQLGCYFCNDV 525
            ..||:..:|               .|.|:...|..      |...|  :..|:|...|......|
Zfish   170 ARRWMNGML---------------LSLLIYEDGVL------DPSSI--IPLIDGGTEGFKGNARV 211

  Fly   526 TAPG-NSLKDRTLD--------QQCTV-TRPGVSNIAASYAVELL----------VALLQHPRKE 570
            ..|| .:..|.||:        ..||: :.|.:......|...||          |.|.....|.
Zfish   212 ILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEHCVEYVRMLLWPKEKPFGDGVVLDGDDPKH 276

  Fly   571 LAPAYYAQSGRGRSEETEEKVPE-GLLGILPHSIRGMLCNYENILPATQK-----FAQC------ 623
            :...|         :::.|:..| .:.|:.....:|::   :.|:||...     .|.|      
Zfish   277 IQWVY---------QKSLERAAEFNITGVTYRLTQGVV---KRIIPAVASTNAVIAAACATEVFK 329

  Fly   624 IACSAAV-LNEY 634
            ||.||.| ||.|
Zfish   330 IATSAYVPLNNY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 91/402 (23%)
E1_like_apg7 11..682 CDD:273590 91/402 (23%)
Apg7 341..658 CDD:238763 79/333 (24%)
uba3NP_998632.1 Interaction with ube2m N-terminus. /evidence=ECO:0000250 52..69 3/16 (19%)
ThiF 66..>240 CDD:279270 55/222 (25%)
Uba3_RUB 70..367 CDD:238765 79/333 (24%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 156..160 1/3 (33%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 191..216 6/26 (23%)
Interaction with nedd8. /evidence=ECO:0000250 226..228 0/1 (0%)
Interaction with nae1. /evidence=ECO:0000250 241..247 1/5 (20%)
Interaction with nae1. /evidence=ECO:0000250 291..294 0/2 (0%)
Interaction with ube2m N-terminus. /evidence=ECO:0000250 330..337 4/6 (67%)
Interaction with nedd8. /evidence=ECO:0000250 351..356
Interaction with ube2m core domain. /evidence=ECO:0000250 367..462
E2_bind 375..460 CDD:285976
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.