DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba3

DIOPT Version :9

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster


Alignment Length:144 Identity:42/144 - (29%)
Similarity:59/144 - (40%) Gaps:33/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 NLEIISQTKC--LLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNR 395
            |||.: ||||  |:.|||.|||.:.::|...||.::.::|...:..||..||.|:...|..|.  
  Fly    41 NLEFL-QTKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGAS-- 102

  Fly   396 MKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKL-----VQDHDVIFL 455
             ||..||   :.||....|                   .:...|.|.|:..     .|.|.|:..
  Fly   103 -KAECAA---RFINARVPT-------------------CRVTPHFKKIQDFDESFYQQFHLVVCG 144

  Fly   456 LTDSRESRWLPTLL 469
            |......||:..:|
  Fly   145 LDSIVARRWINGML 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029
E1_like_apg7 11..682 CDD:273590 42/144 (29%)
Apg7 341..658 CDD:238763 37/136 (27%)
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 37/136 (27%)
Uba3_RUB 50..346 CDD:238765 35/134 (26%)
E2_bind 357..442 CDD:285976
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.