DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg7 and Uba3

DIOPT Version :10

Sequence 1:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster


Alignment Length:144 Identity:42/144 - (29%)
Similarity:59/144 - (40%) Gaps:33/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 NLEIISQTKC--LLFGAGTLGCAVARNLLSWGFKHITLLDSGKVGFSNPVRQNLYTHADAVAGNR 395
            |||.: ||||  |:.|||.|||.:.::|...||.::.::|...:..||..||.|:...|..|.  
  Fly    41 NLEFL-QTKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGAS-- 102

  Fly   396 MKATTAAQRLKEINPSAETAGYVLEIPMPGHTIGESLLAQTKEHLKVIEKL-----VQDHDVIFL 455
             ||..||   :.||....|                   .:...|.|.|:..     .|.|.|:..
  Fly   103 -KAECAA---RFINARVPT-------------------CRVTPHFKKIQDFDESFYQQFHLVVCG 144

  Fly   456 LTDSRESRWLPTLL 469
            |......||:..:|
  Fly   145 LDSIVARRWINGML 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg7NP_611350.1 E1_like_apg7 11..682 CDD:273590 42/144 (29%)
Uba3NP_610913.1 Uba3_RUB 50..346 CDD:238765 35/134 (26%)
E2_bind 357..442 CDD:462611
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.